Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of RABIF monoclonal antibody (M01A), clone 2G3
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
More info about RABIF monoclonal antibody (M01A), clone 2G3
| Brand: | Abnova |
| Reference: | H00005877-M01A |
| Product name: | RABIF monoclonal antibody (M01A), clone 2G3 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant RABIF. |
| Clone: | 2G3 |
| Isotype: | IgG1 Kappa |
| Gene id: | 5877 |
| Gene name: | RABIF |
| Gene alias: | MSS4|RASGFR3|RASGRF3 |
| Gene description: | RAB interacting factor |
| Genbank accession: | BC018488 |
| Immunogen: | RABIF (AAH18488, 1 a.a. ~ 123 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MEPAEQPSELVSAEGRNRKAVLCQRCGSRVLQPGTALFSRRQLFLPSMRKKPALSDGSNPDGDLLQEHWLVEDMFIFENVGFTKDVGNIKFLVCADCEIGPIGWHCLDDKNSFYVALERVSHE |
| Protein accession: | AAH18488 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |