RAB27B purified MaxPab mouse polyclonal antibody (B01P) View larger

RAB27B purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RAB27B purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about RAB27B purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00005874-B01P
Product name: RAB27B purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human RAB27B protein.
Gene id: 5874
Gene name: RAB27B
Gene alias: -
Gene description: RAB27B, member RAS oncogene family
Genbank accession: BC027474
Immunogen: RAB27B (AAH27474, 1 a.a. ~ 218 a.a) full-length human protein.
Immunogen sequence/protein sequence: MTDGDYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYNAQGPNGSSGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRSWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARELADKYGIPYFETSAATGQNVEKAVETLLDLIMKRMEQCVEKTQIPDTVNGGNSGNLDGEKPPEKKCIC
Protein accession: AAH27474
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005874-B01P-13-15-1.jpg
Application image note: Western Blot analysis of RAB27B expression in transfected 293T cell line (H00005874-T01) by RAB27B MaxPab polyclonal antibody.

Lane 1: RAB27B transfected lysate(24.09 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy RAB27B purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart