Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of RAB27A monoclonal antibody (M01), clone 4C1
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
More info about RAB27A monoclonal antibody (M01), clone 4C1
| Brand: | Abnova |
| Reference: | H00005873-M01 |
| Product name: | RAB27A monoclonal antibody (M01), clone 4C1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant RAB27A. |
| Clone: | 4C1 |
| Isotype: | IgG1 Kappa |
| Gene id: | 5873 |
| Gene name: | RAB27A |
| Gene alias: | GS2|HsT18676|MGC117246|RAB27|RAM |
| Gene description: | RAB27A, member RAS oncogene family |
| Genbank accession: | NM_004580 |
| Immunogen: | RAB27A (NP_004571, 122 a.a. ~ 221 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | YCENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGACGC |
| Protein accession: | NP_004571 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | RAB27A monoclonal antibody (M01), clone 4C1. Western Blot analysis of RAB27A expression in HL-60 ( Cat # L014V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | A novel P53/POMC/Gαs/SASH1 autoregulatory feedback loop activates mutated SASH1 to cause pathologic hyperpigmentation.Zhou D, Wei Z, Kuang Z, Luo H, Ma J, Zeng X, Wang K, Liu B, Gong F, Wang J, Lei S, Wang D, Zeng J, Wang T, He Y, Yuan Y, Dai H, He L, Xing Q. J Cell Mol Med. 2016 Nov 25. [Epub ahead of print] |