QDPR polyclonal antibody (A01) View larger

QDPR polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of QDPR polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about QDPR polyclonal antibody (A01)

Brand: Abnova
Reference: H00005860-A01
Product name: QDPR polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a full-length recombinant QDPR.
Gene id: 5860
Gene name: QDPR
Gene alias: DHPR|FLJ42391|PKU2|SDR33C1
Gene description: quinoid dihydropteridine reductase
Genbank accession: BC000576
Immunogen: QDPR (AAH00576, 1 a.a. ~ 244 a.a) full-length recombinant protein with GST tag.
Immunogen sequence/protein sequence: MAAAAAAGEARRVLVYGGRGALGSRCVQAFRARNWWVASVDVVENEEASASIIVKMTDSFTEQADQVTAEVGKLLGEEKVDAILCVAGGWAGGNAKSKSLFKNCDLMWKQSIWTSTISSHLATKHLKEGGLLTLAGAKAALDGTPGMIGYGMAKGAVHQLCQSLAGKNSGMPPGAAAIAVLPVTLDTPMNRKSMPEADFSSWTPLEFLVETFHDWITGKNRPSSGSLIQVVTTEGRTELTPAYF
Protein accession: AAH00576
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005860-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (52.95 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy QDPR polyclonal antibody (A01) now

Add to cart