PEX19 purified MaxPab mouse polyclonal antibody (B01P) View larger

PEX19 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PEX19 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,WB-Tr

More info about PEX19 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00005824-B01P
Product name: PEX19 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human PEX19 protein.
Gene id: 5824
Gene name: PEX19
Gene alias: D1S2223E|HK33|PMP1|PMPI|PXF|PXMP1
Gene description: peroxisomal biogenesis factor 19
Genbank accession: NM_002857.2
Immunogen: PEX19 (NP_002848.1, 1 a.a. ~ 299 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAAAEEGCSVGAEADRELEELLESALDDFDKAKPSPAPPSTTTAPDASGPQKRSPGDTAKDALFASQEKFFQELFDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDMTSQQEFTSCLKETLSGLAKNATDLQNSSMSEEELTKAMEGLGMDEGDGEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLPPEQFEKYQEQHSVMCKICEQFEAETPTDSETTQKARFEMVLDLMQQLQDLGHPPKELAGEMPPGLNFDLDALNLSGPPGASGEQCLIM
Protein accession: NP_002848.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005824-B01P-13-15-1.jpg
Application image note: Western Blot analysis of PEX19 expression in transfected 293T cell line (H00005824-T03) by PEX19 MaxPab polyclonal antibody.

Lane 1: PEX19 transfected lysate(32.89 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ce,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PEX19 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart