PVRL1 (Human) Recombinant Protein (Q01) View larger

PVRL1 (Human) Recombinant Protein (Q01)

New product

374,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PVRL1 (Human) Recombinant Protein (Q01)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about PVRL1 (Human) Recombinant Protein (Q01)

Brand: Abnova
Reference: H00005818-Q01
Product name: PVRL1 (Human) Recombinant Protein (Q01)
Product description: Human PVRL1 partial ORF ( NP_002846, 33 a.a. - 142 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 5818
Gene name: PVRL1
Gene alias: CD111|CLPED1|ED4|HIgR|HVEC|MGC142031|MGC16207|OFC7|PRR|PRR1|PVRR|PVRR1|SK-12|nectin-1
Gene description: poliovirus receptor-related 1 (herpesvirus entry mediator C)
Genbank accession: NM_002855
Immunogen sequence/protein sequence: VQVNDSMYGFIGTDVVLHCSFANPLPSVKITQVTWQKSTNGSKQNVAIYNPSMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELEDEGVYICEFATFPTGNRESQLNLTV
Protein accession: NP_002846
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture: qc_test-H00005818-Q01-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PVRL1 (Human) Recombinant Protein (Q01) now

Add to cart