PURA monoclonal antibody (M05), clone 3A9 View larger

PURA monoclonal antibody (M05), clone 3A9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PURA monoclonal antibody (M05), clone 3A9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Rat
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about PURA monoclonal antibody (M05), clone 3A9

Brand: Abnova
Reference: H00005813-M05
Product name: PURA monoclonal antibody (M05), clone 3A9
Product description: Mouse monoclonal antibody raised against a partial recombinant PURA.
Clone: 3A9
Isotype: IgG2a Kappa
Gene id: 5813
Gene name: PURA
Gene alias: PUR-ALPHA|PUR1|PURALPHA
Gene description: purine-rich element binding protein A
Genbank accession: NM_005859
Immunogen: PURA (NP_005850, 183 a.a. ~ 292 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: TQGQTIALPAQGLIEFRDALAKLIDDYGVEEEPAELPEGTSLTVDNKRFFFDVGSNKYGVFMRVSEVKPTYRNSITVPYKVWAKFGHTFCKYSEETKKIQEKQREKRAAC
Protein accession: NP_005850
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005813-M05-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Rat
Application image: H00005813-M05-1-11-1.jpg
Application image note: PURA monoclonal antibody (M05), clone 3A9. Western Blot analysis of PURA expression in PC-12 ( Cat # L012V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PURA monoclonal antibody (M05), clone 3A9 now

Add to cart