PTS purified MaxPab rabbit polyclonal antibody (D01P) View larger

PTS purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PTS purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr

More info about PTS purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00005805-D01P
Product name: PTS purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human PTS protein.
Gene id: 5805
Gene name: PTS
Gene alias: FLJ97081|PTPS
Gene description: 6-pyruvoyltetrahydropterin synthase
Genbank accession: NM_000317.1
Immunogen: PTS (NP_000308.1, 1 a.a. ~ 145 a.a) full-length human protein.
Immunogen sequence/protein sequence: MSTEGGGRRCQAQVSRRISFSASHRLYSKFLSDEENLKLFGKCNNPNGHGHNYKVVVTVHGEIDPATGMVMNLADLKKYMEEAIMQPLDHKNLDMDVPYFADVVSTTENVAVYIWDNLQKVLPVGVLYKVKVYETDNNIVVYKGE
Protein accession: NP_000308.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00005805-D01P-13-15-1.jpg
Application image note: Western Blot analysis of PTS expression in transfected 293T cell line (H00005805-T02) by PTS MaxPab polyclonal antibody.

Lane 1: PTS transfected lysate(16.40 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PTS purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart