Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PTPRM polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about PTPRM polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00005797-A01 |
| Product name: | PTPRM polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant PTPRM. |
| Gene id: | 5797 |
| Gene name: | PTPRM |
| Gene alias: | MGC166994|PTPRL1|R-PTP-MU|RPTPM|RPTPU|hR-PTPu |
| Gene description: | protein tyrosine phosphatase, receptor type, M |
| Genbank accession: | NM_002845 |
| Immunogen: | PTPRM (NP_002836, 381 a.a. ~ 479 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | RGPRKLEVVEVKSRQITIRWEPFGYNVTRCHSYNLTVHYCYQVGGQEQVREEVSWDTENSHPQHTITNLSPYTNVSVKLILMNPEGRKESQELIVQTDE |
| Protein accession: | NP_002836 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |