H00005791-M04_100ug
New product
Availability date:
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IF,S-ELISA,ELISA |
Brand: | Abnova |
Reference: | H00005791-M04 |
Product name: | PTPRE monoclonal antibody (M04), clone 2D10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PTPRE. |
Clone: | 2D10 |
Isotype: | IgG2a Kappa |
Gene id: | 5791 |
Gene name: | PTPRE |
Gene alias: | DKFZp313F1310|FLJ57799|FLJ58245|HPTPE|PTPE|R-PTP-EPSILON |
Gene description: | protein tyrosine phosphatase, receptor type, E |
Genbank accession: | BC050062 |
Immunogen: | PTPRE (AAH50062, 511 a.a. ~ 600 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | WRMIWEWKSHTIVMLTEVQEREQDKCYQYWPTEGSVTHGEITIEIKNDTLSEAISIRDFLVTLNQPQARQEEQVRVVRQFHFHGWPEIGI |
Protein accession: | AAH50062 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Detection limit for recombinant GST tagged PTPRE is approximately 10ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA |
Shipping condition: | Dry Ice |