PTPRE monoclonal antibody (M04), clone 2D10 View larger

PTPRE monoclonal antibody (M04), clone 2D10

H00005791-M04_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PTPRE monoclonal antibody (M04), clone 2D10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA

More info about PTPRE monoclonal antibody (M04), clone 2D10

Brand: Abnova
Reference: H00005791-M04
Product name: PTPRE monoclonal antibody (M04), clone 2D10
Product description: Mouse monoclonal antibody raised against a partial recombinant PTPRE.
Clone: 2D10
Isotype: IgG2a Kappa
Gene id: 5791
Gene name: PTPRE
Gene alias: DKFZp313F1310|FLJ57799|FLJ58245|HPTPE|PTPE|R-PTP-EPSILON
Gene description: protein tyrosine phosphatase, receptor type, E
Genbank accession: BC050062
Immunogen: PTPRE (AAH50062, 511 a.a. ~ 600 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: WRMIWEWKSHTIVMLTEVQEREQDKCYQYWPTEGSVTHGEITIEIKNDTLSEAISIRDFLVTLNQPQARQEEQVRVVRQFHFHGWPEIGI
Protein accession: AAH50062
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005791-M04-9-17-1.jpg
Application image note: Detection limit for recombinant GST tagged PTPRE is approximately 10ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy PTPRE monoclonal antibody (M04), clone 2D10 now

Add to cart