PTPN14 monoclonal antibody (M01), clone 4F7 View larger

PTPN14 monoclonal antibody (M01), clone 4F7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PTPN14 monoclonal antibody (M01), clone 4F7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about PTPN14 monoclonal antibody (M01), clone 4F7

Brand: Abnova
Reference: H00005784-M01
Product name: PTPN14 monoclonal antibody (M01), clone 4F7
Product description: Mouse monoclonal antibody raised against a partial recombinant PTPN14.
Clone: 4F7
Isotype: IgG2a Kappa
Gene id: 5784
Gene name: PTPN14
Gene alias: MGC126803|PEZ|PTP36
Gene description: protein tyrosine phosphatase, non-receptor type 14
Genbank accession: NM_005401.4
Immunogen: PTPN14 (NP_005392.2, 303 a.a. ~ 412 a.a) partial recombinant protein with GST-pstS1 tag.
Immunogen sequence/protein sequence: KQNKICTEQSNSPPPIRRQPTWSRSSLPRQQPYILPPVHVQCGEHYSETHTSQDSIFHGNEEALYCNSHNSLDLNYLNGTVTNGSVCSVHSVNSLNCSQSFIQASPVSSN
Protein accession: NP_005392.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005784-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (40.04 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005784-M01-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged PTPN14 is 0.03 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PTPN14 monoclonal antibody (M01), clone 4F7 now

Add to cart