Brand: | Abnova |
Reference: | H00005784-M01 |
Product name: | PTPN14 monoclonal antibody (M01), clone 4F7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PTPN14. |
Clone: | 4F7 |
Isotype: | IgG2a Kappa |
Gene id: | 5784 |
Gene name: | PTPN14 |
Gene alias: | MGC126803|PEZ|PTP36 |
Gene description: | protein tyrosine phosphatase, non-receptor type 14 |
Genbank accession: | NM_005401.4 |
Immunogen: | PTPN14 (NP_005392.2, 303 a.a. ~ 412 a.a) partial recombinant protein with GST-pstS1 tag. |
Immunogen sequence/protein sequence: | KQNKICTEQSNSPPPIRRQPTWSRSSLPRQQPYILPPVHVQCGEHYSETHTSQDSIFHGNEEALYCNSHNSLDLNYLNGTVTNGSVCSVHSVNSLNCSQSFIQASPVSSN |
Protein accession: | NP_005392.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (40.04 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged PTPN14 is 0.03 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |