PTPN4 monoclonal antibody (M01), clone 3C8 View larger

PTPN4 monoclonal antibody (M01), clone 3C8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PTPN4 monoclonal antibody (M01), clone 3C8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about PTPN4 monoclonal antibody (M01), clone 3C8

Brand: Abnova
Reference: H00005775-M01
Product name: PTPN4 monoclonal antibody (M01), clone 3C8
Product description: Mouse monoclonal antibody raised against a partial recombinant PTPN4.
Clone: 3C8
Isotype: IgG3 Kappa
Gene id: 5775
Gene name: PTPN4
Gene alias: PTPMEG|PTPMEG1
Gene description: protein tyrosine phosphatase, non-receptor type 4 (megakaryocyte)
Genbank accession: NM_002830
Immunogen: PTPN4 (NP_002821, 361 a.a. ~ 460 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: KPLARKLMDWEVVSRNSISDDRLETQSLPSRSPPGTPNHRNSTFTQEGTRLRPSSVGHLVDHMVHTSPSEVFVNQRSPSSTQANSIVLESSPSQETPGDG
Protein accession: NP_002821
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005775-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005775-M01-9-18-1.jpg
Application image note: Detection limit for recombinant GST tagged PTPN4 is approximately 3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PTPN4 monoclonal antibody (M01), clone 3C8 now

Add to cart