PTPN1 purified MaxPab mouse polyclonal antibody (B01P) View larger

PTPN1 purified MaxPab mouse polyclonal antibody (B01P)

H00005770-B01P_50ug

New product

395,00 € tax excl.

50 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PTPN1 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,WB-Tr

More info about PTPN1 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00005770-B01P
Product name: PTPN1 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human PTPN1 protein.
Gene id: 5770
Gene name: PTPN1
Gene alias: PTP1B
Gene description: protein tyrosine phosphatase, non-receptor type 1
Genbank accession: NM_002827.2
Immunogen: PTPN1 (NP_002818.1, 1 a.a. ~ 435 a.a) full-length human protein.
Immunogen sequence/protein sequence: MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLEPPPEHIPPPPRPPKRILEPHNGKCREFFPNHQWVKEETQEDKDCPIKEEKGSPLNAAPYGIESMSQDTEVRSRVVGGSLRGAQAASPAKGEPSLPEKDEDHALSYWKPFLVNMCVATVLTAGAYLCYRFLFNSNT
Protein accession: NP_002818.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005770-B01P-13-15-1.jpg
Application image note: Western Blot analysis of PTPN1 expression in transfected 293T cell line (H00005770-T01) by PTPN1 MaxPab polyclonal antibody.

Lane 1: PTPN1 transfected lysate(47.85 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PTPN1 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart