Brand: | Abnova |
Reference: | H00005763-M10 |
Product name: | PTMS monoclonal antibody (M10), clone 2D3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PTMS. |
Clone: | 2D3 |
Isotype: | IgG2a Kappa |
Gene id: | 5763 |
Gene name: | PTMS |
Gene alias: | ParaT |
Gene description: | parathymosin |
Genbank accession: | BC017025 |
Immunogen: | PTMS (AAH17025, 1 a.a. ~ 102 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MSEKSVEAAAELSAKDLKEKKEKVEEKASRKERKKEVVEEEENGAEEEEEETAEDGEEEDEGEEEDEEEEEEDDEGPALKRAAEEEDEADPKRQKTENGASA |
Protein accession: | AAH17025 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.85 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to PTMS on formalin-fixed paraffin-embedded human placenta. [antibody concentration 1.5 ug/ml] |
Applications: | IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |