Brand: | Abnova |
Reference: | H00005747-M02 |
Product name: | PTK2 monoclonal antibody (M02), clone 1C1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PTK2. |
Clone: | 1C1 |
Isotype: | IgG1 Kappa |
Gene id: | 5747 |
Gene name: | PTK2 |
Gene alias: | FADK|FAK|FAK1|pp125FAK |
Gene description: | PTK2 protein tyrosine kinase 2 |
Genbank accession: | BC028733 |
Immunogen: | PTK2 (AAH28733, 355 a.a. ~ 490 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | EGFYPSPQHMVQTNHYQVSGYPGSHGITAMAGSIYPGQASLLDQTDSWNHRPQEIAMWQPNVEDSTVLDLRGIGQVLPTHLMEERLIRQQQEMEEDQRWLEKEERFLKPDVRLSRGSIDREDGSLQGPIGNQHIYQ |
Protein accession: | AAH28733 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00005747-M02-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00005747-M02-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (40.59 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00005747-M02-1-25-1.jpg](http://www.abnova.com/application_image/H00005747-M02-1-25-1.jpg) |
Application image note: | PTK2 monoclonal antibody (M02), clone 1C1 Western Blot analysis of PTK2 expression in Hela S3 NE ( Cat # L013V3 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |