Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PTK2 monoclonal antibody (M01), clone 2C3
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re,IP,PLA-Ce |
More info about PTK2 monoclonal antibody (M01), clone 2C3
| Brand: | Abnova |
| Reference: | H00005747-M01 |
| Product name: | PTK2 monoclonal antibody (M01), clone 2C3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PTK2. |
| Clone: | 2C3 |
| Isotype: | IgG1 Kappa |
| Gene id: | 5747 |
| Gene name: | PTK2 |
| Gene alias: | FADK|FAK|FAK1|pp125FAK |
| Gene description: | PTK2 protein tyrosine kinase 2 |
| Genbank accession: | BC028733 |
| Immunogen: | PTK2 (AAH28733, 355 a.a. ~ 490 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | EGFYPSPQHMVQTNHYQVSGYPGSHGITAMAGSIYPGQASLLDQTDSWNHRPQEIAMWQPNVEDSTVLDLRGIGQVLPTHLMEERLIRQQQEMEEDQRWLEKEERFLKPDVRLSRGSIDREDGSLQGPIGNQHIYQ |
| Protein accession: | AAH28733 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (40.59 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | PTK2 monoclonal antibody (M01), clone 2C3 Western Blot analysis of PTK2 expression in Hela S3 NE ( Cat # L013V3 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,IP,PLA-Ce |
| Shipping condition: | Dry Ice |
| Publications: | JNK Pathway-associated Phosphatase Dephosphorylates Focal Adhesion Kinase and Suppresses Cell Migration.Li JP, Fu YN, Chen YR, Tan TH. J Biol Chem. 2010 Feb 19;285(8):5472-8. Epub 2009 Dec 14. |