Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PTHLH monoclonal antibody (M01), clone 3H1-5G8
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IHC-P,IF,S-ELISA,ELISA,WB-Re |
More info about PTHLH monoclonal antibody (M01), clone 3H1-5G8
| Brand: | Abnova |
| Reference: | H00005744-M01 |
| Product name: | PTHLH monoclonal antibody (M01), clone 3H1-5G8 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant PTHLH. |
| Clone: | 3H1-5G8 |
| Isotype: | IgG2b kappa |
| Gene id: | 5744 |
| Gene name: | PTHLH |
| Gene alias: | HHM|MGC14611|PLP|PTHR|PTHRP |
| Gene description: | parathyroid hormone-like hormone |
| Genbank accession: | BC005961 |
| Immunogen: | PTHLH (AAH05961, 1 a.a. ~ 175 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MQRRLVQQWSVAVFLLSYAVPSCGRSVEGLSRRLKRAVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATSEVSPNSKPSPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLSDTSTTSLELDSR |
| Protein accession: | AAH05961 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (44.99 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to PTHLH on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml] |
| Applications: | IHC-P,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | The Expression of PTHLH in Human Gastric Mucosa Enterochromaffin-Like Cells.Liu C, Chen J, Guo Y, Yang L, Zhao C, Bai L. Dig Dis Sci. 2010 Sep 16. [Epub ahead of print] |