PTH monoclonal antibody (M14), clone 3E7 View larger

PTH monoclonal antibody (M14), clone 3E7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PTH monoclonal antibody (M14), clone 3E7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Tr

More info about PTH monoclonal antibody (M14), clone 3E7

Brand: Abnova
Reference: H00005741-M14
Product name: PTH monoclonal antibody (M14), clone 3E7
Product description: Mouse monoclonal antibody raised against a full-length recombinant PTH.
Clone: 3E7
Isotype: IgG1 Kappa
Gene id: 5741
Gene name: PTH
Gene alias: PTH1
Gene description: parathyroid hormone
Genbank accession: N/A
Immunogen: PTH (NP_000306, 32 a.a.-115 a.a.) full-length recombinant protein.
Immunogen sequence/protein sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ
Protein accession: -
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005741-M14-13-15-1.jpg
Application image note: Western Blot analysis of PTH expression in transfected 293T cell line by PTH monoclonal antibody (M14), clone 3E7.

Lane 1: PTH transfected lysate(12.9 KDa).
Lane 2: Non-transfected lysate.
Applications: ELISA,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PTH monoclonal antibody (M14), clone 3E7 now

Add to cart