Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PTH monoclonal antibody (M10), clone 3B5
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
More info about PTH monoclonal antibody (M10), clone 3B5
| Brand: | Abnova |
| Reference: | H00005741-M10 |
| Product name: | PTH monoclonal antibody (M10), clone 3B5 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant PTH. |
| Clone: | 3B5 |
| Isotype: | IgG2a Kappa |
| Gene id: | 5741 |
| Gene name: | PTH |
| Gene alias: | PTH1 |
| Gene description: | parathyroid hormone |
| Genbank accession: | N/A |
| Immunogen: | PTH (NP_000306, 32 a.a.-115 a.a.) full-length recombinant protein. |
| Immunogen sequence/protein sequence: | SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ |
| Protein accession: | - |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |