PTH monoclonal antibody (M07), clone 4D7 View larger

PTH monoclonal antibody (M07), clone 4D7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PTH monoclonal antibody (M07), clone 4D7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,IP

More info about PTH monoclonal antibody (M07), clone 4D7

Brand: Abnova
Reference: H00005741-M07
Product name: PTH monoclonal antibody (M07), clone 4D7
Product description: Mouse monoclonal antibody raised against a full-length recombinant PTH.
Clone: 4D7
Isotype: IgG2a Kappa
Gene id: 5741
Gene name: PTH
Gene alias: PTH1
Gene description: parathyroid hormone
Genbank accession: N/A
Immunogen: PTH (NP_000306, 32 a.a.-115 a.a.) full-length recombinant protein.
Immunogen sequence/protein sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ
Protein accession: -
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005741-M07-31-15-1.jpg
Application image note: Immunoprecipitation of PTH transfected lysate using anti-PTH monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with PTH MaxPab rabbit polyclonal antibody.
Applications: ELISA,IP
Shipping condition: Dry Ice

Reviews

Buy PTH monoclonal antibody (M07), clone 4D7 now

Add to cart