Brand: | Abnova |
Reference: | H00005741-M06 |
Product name: | PTH monoclonal antibody (M06), clone 1E1 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant PTH. |
Clone: | 1E1 |
Isotype: | IgG2a Kappa |
Gene id: | 5741 |
Gene name: | PTH |
Gene alias: | PTH1 |
Gene description: | parathyroid hormone |
Genbank accession: | N/A |
Immunogen: | PTH (NP_000306, 32 a.a.-115 a.a.) full-length recombinant protein. |
Immunogen sequence/protein sequence: | SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ |
Protein accession: | - |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00005741-M06-31-15-1.jpg](http://www.abnova.com/application_image/H00005741-M06-31-15-1.jpg) |
Application image note: | Immunoprecipitation of PTH transfected lysate using anti-PTH monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with PTH MaxPab rabbit polyclonal antibody. |
Applications: | ELISA,IP |
Shipping condition: | Dry Ice |