Brand: | Abnova |
Reference: | H00005728-M02A |
Product name: | PTEN monoclonal antibody (M02A), clone 3E7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PTEN. |
Clone: | 3E7 |
Isotype: | IgG2a Kappa |
Gene id: | 5728 |
Gene name: | PTEN |
Gene alias: | 10q23del|BZS|MGC11227|MHAM|MMAC1|PTEN1|TEP1 |
Gene description: | phosphatase and tensin homolog |
Genbank accession: | NM_000314.1 |
Immunogen: | PTEN (NP_000305.1, 2 a.a. ~ 91 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | TAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKHKNHYKIYNLCAERHYDTAKFNCRVAQYPFE |
Protein accession: | NP_000305 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.41 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | PTEN monoclonal antibody (M02A), clone 3E7 Western Blot analysis of PTEN expression in C32 ( Cat # L002V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |