PTEN monoclonal antibody (M02A), clone 3E7 View larger

PTEN monoclonal antibody (M02A), clone 3E7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PTEN monoclonal antibody (M02A), clone 3E7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about PTEN monoclonal antibody (M02A), clone 3E7

Brand: Abnova
Reference: H00005728-M02A
Product name: PTEN monoclonal antibody (M02A), clone 3E7
Product description: Mouse monoclonal antibody raised against a partial recombinant PTEN.
Clone: 3E7
Isotype: IgG2a Kappa
Gene id: 5728
Gene name: PTEN
Gene alias: 10q23del|BZS|MGC11227|MHAM|MMAC1|PTEN1|TEP1
Gene description: phosphatase and tensin homolog
Genbank accession: NM_000314.1
Immunogen: PTEN (NP_000305.1, 2 a.a. ~ 91 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: TAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKHKNHYKIYNLCAERHYDTAKFNCRVAQYPFE
Protein accession: NP_000305
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005728-M02A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.41 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005728-M02A-1-17-1.jpg
Application image note: PTEN monoclonal antibody (M02A), clone 3E7 Western Blot analysis of PTEN expression in C32 ( Cat # L002V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PTEN monoclonal antibody (M02A), clone 3E7 now

Add to cart