Brand: | Abnova |
Reference: | H00005728-M01 |
Product name: | PTEN monoclonal antibody (M01), clone 2G9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PTEN. |
Clone: | 2G9 |
Isotype: | IgG2a Kappa |
Gene id: | 5728 |
Gene name: | PTEN |
Gene alias: | 10q23del|BZS|MGC11227|MHAM|MMAC1|PTEN1|TEP1 |
Gene description: | phosphatase and tensin homolog |
Genbank accession: | BC005821 |
Immunogen: | PTEN (AAH05821, 221 a.a. ~ 320 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | KVKIYSSNSGPTRREDKFMYFEFPQPLPVCGDIKVEFFHKQNKMLKKDKMFHFWVNTFFIPGPEETSEKVENGSLCDQEIDSICSIERADNDKEYLVLTL |
Protein accession: | AAH05821 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00005728-M01-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00005728-M01-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00005728-M01-9-20-1.jpg](http://www.abnova.com/application_image/H00005728-M01-9-20-1.jpg) |
Application image note: | Detection limit for recombinant GST tagged PTEN is approximately 0.3ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re,PLA-Ce |
Shipping condition: | Dry Ice |