Brand: | Abnova |
Reference: | H00005727-M07 |
Product name: | PTCH monoclonal antibody (M07), clone 1D9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PTCH. |
Clone: | 1D9 |
Isotype: | IgG2a Kappa |
Gene id: | 5727 |
Gene name: | PTCH1 |
Gene alias: | BCNS|FLJ26746|FLJ42602|HPE7|NBCCS|PTC|PTC1|PTCH|PTCH11 |
Gene description: | patched homolog 1 (Drosophila) |
Genbank accession: | NM_000264 |
Immunogen: | PTCH (NP_000255, 841 a.a. ~ 940 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PKMWLHYFRDWLQGLQDAFDSDWETGKIMPNNYKNGSDDGVLAYKLLVQTGSRDKPIDISQLTKQRLVDADGIINPSAFYIYLTAWVSNDPVAYAASQAN |
Protein accession: | NP_000255 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged PTCH is approximately 0.3ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |