PTCH polyclonal antibody (A01) View larger

PTCH polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PTCH polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about PTCH polyclonal antibody (A01)

Brand: Abnova
Reference: H00005727-A01
Product name: PTCH polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant PTCH.
Gene id: 5727
Gene name: PTCH1
Gene alias: BCNS|FLJ26746|FLJ42602|HPE7|NBCCS|PTC|PTC1|PTCH|PTCH11
Gene description: patched homolog 1 (Drosophila)
Genbank accession: NM_000264
Immunogen: PTCH (NP_000255, 841 a.a. ~ 940 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: PKMWLHYFRDWLQGLQDAFDSDWETGKIMPNNYKNGSDDGVLAYKLLVQTGSRDKPIDISQLTKQRLVDADGIINPSAFYIYLTAWVSNDPVAYAASQAN
Protein accession: NP_000255
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005727-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.11 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PTCH polyclonal antibody (A01) now

Add to cart