Brand: | Abnova |
Reference: | H00005723-M01A |
Product name: | PSPH monoclonal antibody (M01A), clone 3A5 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant PSPH. |
Clone: | 3A5 |
Isotype: | IgG2b Kappa |
Gene id: | 5723 |
Gene name: | PSPH |
Gene alias: | PSP |
Gene description: | phosphoserine phosphatase |
Genbank accession: | BC063614 |
Immunogen: | PSPH (AAH63614, 1 a.a. ~ 225 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MVSHSELRKLFYSADAVCFDVDSTVIREEGIDELAKICGVEDAVSEMTRRAMGGAVPFKAALTERLALIQPSREQVQRLIAEQPPHLTPGIRELVSRLQERNVQVFLISGGFRSIVEHVASKLNIPATNVFANRLKFYFNGEYAGFDETQPTAESGGKGKVIKLLKEKFHFKKIIMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFVELLGELEE |
Protein accession: | AAH63614 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (50.49 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | PSPH monoclonal antibody (M01A), clone 3A5. Western Blot analysis of PSPH expression in human placenta. |
Applications: | WB-Ti,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |