PSPH purified MaxPab rabbit polyclonal antibody (D01P) View larger

PSPH purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PSPH purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr

More info about PSPH purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00005723-D01P
Product name: PSPH purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human PSPH protein.
Gene id: 5723
Gene name: PSPH
Gene alias: PSP
Gene description: phosphoserine phosphatase
Genbank accession: NM_004577.3
Immunogen: PSPH (NP_004568.2, 1 a.a. ~ 225 a.a) full-length human protein.
Immunogen sequence/protein sequence: MVSHSELRKLFYSADAVCFDVDSTVIREEGIDELAKICGVEDAVSEMTRRAMGGAVPFKAALTERLALIQPSREQVQRLIAEQPPHLTPGIRELVSRLQERNVQVFLISGGFRSIVEHVASKLNIPATNVFANRLKFYFNGEYAGFDETQPTAESGGKGKVIKLLKEKFHFKKIIMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFVELLGELEE
Protein accession: NP_004568.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00005723-D01P-13-15-1.jpg
Application image note: Western Blot analysis of PSPH expression in transfected 293T cell line (H00005723-T01) by PSPH MaxPab polyclonal antibody.

Lane 1: PSPH transfected lysate(25.00 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PSPH purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart