Brand: | Abnova |
Reference: | H00005721-M02 |
Product name: | PSME2 monoclonal antibody (M02), clone 1G4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PSME2. |
Clone: | 1G4 |
Isotype: | IgG2a Kappa |
Gene id: | 5721 |
Gene name: | PSME2 |
Gene alias: | PA28B|PA28beta|REGbeta |
Gene description: | proteasome (prosome, macropain) activator subunit 2 (PA28 beta) |
Genbank accession: | NM_002818 |
Immunogen: | PSME2 (NP_002809, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MAKPCGVRLSGEARKQVEVFRQNLFQEAEEFLYRFLPQKIIYLNQLLQEDSLNVADLTSLRAPLDIPIPDPPPKDDEMETDKQEKKEVHK |
Protein accession: | NP_002809 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.64 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to PSME2 on formalin-fixed paraffin-embedded human stomach carcinoma. [antibody concentration 6 ug/ml] |
Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr,IP |
Shipping condition: | Dry Ice |