PSME1 purified MaxPab mouse polyclonal antibody (B02P) View larger

PSME1 purified MaxPab mouse polyclonal antibody (B02P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PSME1 purified MaxPab mouse polyclonal antibody (B02P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,WB-Tr

More info about PSME1 purified MaxPab mouse polyclonal antibody (B02P)

Brand: Abnova
Reference: H00005720-B02P
Product name: PSME1 purified MaxPab mouse polyclonal antibody (B02P)
Product description: Mouse polyclonal antibody raised against a full-length human PSME1 protein.
Gene id: 5720
Gene name: PSME1
Gene alias: IFI5111|MGC8628|PA28A|PA28alpha|REGalpha
Gene description: proteasome (prosome, macropain) activator subunit 1 (PA28 alpha)
Genbank accession: NM_006263
Immunogen: PSME1 (NP_006254.1, 1 a.a. ~ 249 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAMLRVQPEAQAKVDVFREDLCTKTENLLGSYFPKKISELDAFLKEPALNEANLSNLKAPLDIPVPDPVKEKEKEERKKQQEKEDKDEKKKGEDEDKGPPCGPVNCNEKIVVLLQRLKPEIKDVIEQLNLVTTWLQLQIPRIEDGNNFGVAVQEKVFELMTSLHTKLEGFHTQISKYFSERGDAVTKAAKQPHVGDYRQLVHELDEAEYRDIRLMVMEIRNAYAVLYDIILKNFEKLKKPRGETKGMIY
Protein accession: NP_006254.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005720-B02P-13-15-1.jpg
Application image note: Western Blot analysis of PSME1 expression in transfected 293T cell line (H00005720-T02) by PSME1 MaxPab polyclonal antibody.

Lane 1: PSME1 transfected lysate(27.39 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PSME1 purified MaxPab mouse polyclonal antibody (B02P) now

Add to cart