PSMD10 monoclonal antibody (M22), clone 1B4 View larger

PSMD10 monoclonal antibody (M22), clone 1B4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PSMD10 monoclonal antibody (M22), clone 1B4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about PSMD10 monoclonal antibody (M22), clone 1B4

Brand: Abnova
Reference: H00005716-M22
Product name: PSMD10 monoclonal antibody (M22), clone 1B4
Product description: Mouse monoclonal antibody raised against a partial recombinant PSMD10.
Clone: 1B4
Isotype: IgG1 Kappa
Gene id: 5716
Gene name: PSMD10
Gene alias: dJ889N15.2|p28
Gene description: proteasome (prosome, macropain) 26S subunit, non-ATPase, 10
Genbank accession: BC011960
Immunogen: PSMD10 (AAH11960, 127 a.a. ~ 226 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: EGGANPDAKDHYEATAMHRAAAKGNLKMIHILLYYKASTNIQDTEGNTPLHLACDEERVEEAKLLVSQGASIYIENKEEKTPLQVAKGGLGLILKRMVEG
Protein accession: AAH11960
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005716-M22-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005716-M22-9-18-1.jpg
Application image note: Detection limit for recombinant GST tagged PSMD10 is 3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PSMD10 monoclonal antibody (M22), clone 1B4 now

Add to cart