PSMD8 purified MaxPab mouse polyclonal antibody (B02P) View larger

PSMD8 purified MaxPab mouse polyclonal antibody (B02P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PSMD8 purified MaxPab mouse polyclonal antibody (B02P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,WB-Tr

More info about PSMD8 purified MaxPab mouse polyclonal antibody (B02P)

Brand: Abnova
Reference: H00005714-B02P
Product name: PSMD8 purified MaxPab mouse polyclonal antibody (B02P)
Product description: Mouse polyclonal antibody raised against a full-length human PSMD8 protein.
Gene id: 5714
Gene name: PSMD8
Gene alias: HIP6|HYPF|MGC1660|Nin1p|Rpn12|S14|p31
Gene description: proteasome (prosome, macropain) 26S subunit, non-ATPase, 8
Genbank accession: NM_002812
Immunogen: PSMD8 (NP_002803.1, 1 a.a. ~ 257 a.a) full-length human protein.
Immunogen sequence/protein sequence: MYEQLKGEWNRKSPNLSKCGEELGRLKLVLLELNFLPTTGTKLTKQQLILARDILEIGAQWSILRKDIPSFERYMAQLKCYYFDYKEQLPESAYMHQLLGLNLLFLLSQNRVAEFHTELERLPAKDIQTNVYIKHPVSLEQYLMEGSYNKVFLAKGNIPAESYTFFIDILLDTIRDEIAGCIEKAYEKILFTEATRILFFNTPKKMTDYAKKRGWVLGPNNYYSFASQQQKPEDTTIPSTELAKQVIEYARQLEMIV
Protein accession: NP_002803.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005714-B02P-13-15-1.jpg
Application image note: Western Blot analysis of PSMD8 expression in transfected 293T cell line (H00005714-T02) by PSMD8 MaxPab polyclonal antibody.

Lane 1: PSMD8 transfected lysate(28.27 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PSMD8 purified MaxPab mouse polyclonal antibody (B02P) now

Add to cart