Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PSMD5 monoclonal antibody (M01), clone 3E2
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
More info about PSMD5 monoclonal antibody (M01), clone 3E2
| Brand: | Abnova |
| Reference: | H00005711-M01 |
| Product name: | PSMD5 monoclonal antibody (M01), clone 3E2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PSMD5. |
| Clone: | 3E2 |
| Isotype: | IgG1 Kappa |
| Gene id: | 5711 |
| Gene name: | PSMD5 |
| Gene alias: | KIAA0072|MGC23145|S5B |
| Gene description: | proteasome (prosome, macropain) 26S subunit, non-ATPase, 5 |
| Genbank accession: | BC014478 |
| Immunogen: | PSMD5 (AAH14478, 405 a.a. ~ 504 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | QPFPELHCAALKVFTAIANQPWAQKLMFNSPGFVEYVVDRSVEHDKASKDAKYELVKALANSKTIAEIFGNPNYLRLRTYLSEGPYYVKPVSTTAVEGAE |
| Protein accession: | AAH14478 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to PSMD5 on formalin-fixed paraffin-embedded human prostate. [antibody concentration 3 ug/ml] |
| Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |