Brand: | Abnova |
Reference: | H00005702-M01 |
Product name: | PSMC3 monoclonal antibody (M01), clone 1B9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PSMC3. |
Clone: | 1B9 |
Isotype: | IgG1 Kappa |
Gene id: | 5702 |
Gene name: | PSMC3 |
Gene alias: | MGC8487|TBP1 |
Gene description: | proteasome (prosome, macropain) 26S subunit, ATPase, 3 |
Genbank accession: | BC008713 |
Immunogen: | PSMC3 (AAH08713, 53 a.a. ~ 152 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MNLLPNIESPVTRQEKMATVWDEAEQDGIGEEVLKMSTEEIIQRTRLLDSEIKIMKSEVLRVTHELQAMKDKIKENSEKIKVNKTLPYLVSNVIELLDVD |
Protein accession: | AAH08713 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | |
Application image note: | PSMC3 monoclonal antibody (M01), clone 1B9 Western Blot analysis of PSMC3 expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |