PSMB9 polyclonal antibody (A01) View larger

PSMB9 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PSMB9 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about PSMB9 polyclonal antibody (A01)

Brand: Abnova
Reference: H00005698-A01
Product name: PSMB9 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a full-length recombinant PSMB9.
Gene id: 5698
Gene name: PSMB9
Gene alias: LMP2|MGC70470|PSMB6i|RING12|beta1i
Gene description: proteasome (prosome, macropain) subunit, beta type, 9 (large multifunctional peptidase 2)
Genbank accession: BC065513
Immunogen: PSMB9 (AAH65513, 1 a.a. ~ 219 a.a) full-length recombinant protein with GST tag.
Immunogen sequence/protein sequence: MLRAGAPTGDLPRAGEVHTGTTIMAVEFDGGVVMGSDSRVSAGEAVVNRVFDKLSPLHERIYCALSGSAADAQAVADMAAYQLELHGIELEEPPLVLAAANVVRNISYKYREDLSAHLMVAGWDQREGGQVYGTLGGMLTRQPFAIGGSGSTFIYGYVDAAYKPGMSPEECRRFTTDAIALAMSRDGSSGGVIYLVTITAAGVDHRVILGNELPKFYDE
Protein accession: AAH65513
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005698-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (50.2 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PSMB9 polyclonal antibody (A01) now

Add to cart