Brand: | Abnova |
Reference: | H00005696-M05 |
Product name: | PSMB8 monoclonal antibody (M05), clone 4E4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PSMB8. |
Clone: | 4E4 |
Isotype: | IgG2a Kappa |
Gene id: | 5696 |
Gene name: | PSMB8 |
Gene alias: | D6S216|D6S216E|LMP7|MGC1491|PSMB5i|RING10|beta5i |
Gene description: | proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctional peptidase 7) |
Genbank accession: | BC001114 |
Immunogen: | PSMB8 (AAH01114, 173 a.a. ~ 272 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | DKKGPGLYYVDEHGTRLSGNMFSTGSGNTYAYGVMDSGYRPNLSPEEAYDLGRRAIAYATHRDSYSGGVVNMYHMKEDGWVKVESTDVSDLLHQYREANQ |
Protein accession: | AAH01114 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00005696-M05-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00005696-M05-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | http://www.abnova.com/application_image/ |
Application image note: | Detection limit for recombinant GST tagged PSMB8 is approximately 10ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |