PSMB8 monoclonal antibody (M03), clone 1G7 View larger

PSMB8 monoclonal antibody (M03), clone 1G7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PSMB8 monoclonal antibody (M03), clone 1G7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re

More info about PSMB8 monoclonal antibody (M03), clone 1G7

Brand: Abnova
Reference: H00005696-M03
Product name: PSMB8 monoclonal antibody (M03), clone 1G7
Product description: Mouse monoclonal antibody raised against a partial recombinant PSMB8.
Clone: 1G7
Isotype: IgG2a Kappa
Gene id: 5696
Gene name: PSMB8
Gene alias: D6S216|D6S216E|LMP7|MGC1491|PSMB5i|RING10|beta5i
Gene description: proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctional peptidase 7)
Genbank accession: BC001114
Immunogen: PSMB8 (AAH01114, 173 a.a. ~ 272 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: DKKGPGLYYVDEHGTRLSGNMFSTGSGNTYAYGVMDSGYRPNLSPEEAYDLGRRAIAYATHRDSYSGGVVNMYHMKEDGWVKVESTDVSDLLHQYREANQ
Protein accession: AAH01114
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005696-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: http://www.abnova.com/application_image/
Application image note: Detection limit for recombinant GST tagged PSMB8 is approximately 30ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PSMB8 monoclonal antibody (M03), clone 1G7 now

Add to cart