Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PSMB8 monoclonal antibody (M01), clone 1B3
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr,IP |
More info about PSMB8 monoclonal antibody (M01), clone 1B3
| Brand: | Abnova |
| Reference: | H00005696-M01 |
| Product name: | PSMB8 monoclonal antibody (M01), clone 1B3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PSMB8. |
| Clone: | 1B3 |
| Isotype: | IgG2a Kappa |
| Gene id: | 5696 |
| Gene name: | PSMB8 |
| Gene alias: | D6S216|D6S216E|LMP7|MGC1491|PSMB5i|RING10|beta5i |
| Gene description: | proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctional peptidase 7) |
| Genbank accession: | BC001114 |
| Immunogen: | PSMB8 (AAH01114, 173 a.a. ~ 272 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | DKKGPGLYYVDEHGTRLSGNMFSTGSGNTYAYGVMDSGYRPNLSPEEAYDLGRRAIAYATHRDSYSGGVVNMYHMKEDGWVKVESTDVSDLLHQYREANQ |
| Protein accession: | AAH01114 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to PSMB8 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml] |
| Applications: | IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr,IP |
| Shipping condition: | Dry Ice |
| Publications: | Endoplasmic reticulum stress activates autophagy but not the proteasome in neuronal cells: implications for Alzheimer's disease.Nijholt DA, de Graaf TR, van Haastert ES, Oliveira AO, Berkers CR, Zwart R, Ovaa H, Baas F, Hoozemans JJ, Scheper W. Cell Death Differ. 2011 Jan 21. [Epub ahead of print] |