PSMB7 purified MaxPab mouse polyclonal antibody (B03P) View larger

PSMB7 purified MaxPab mouse polyclonal antibody (B03P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PSMB7 purified MaxPab mouse polyclonal antibody (B03P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,WB-Tr

More info about PSMB7 purified MaxPab mouse polyclonal antibody (B03P)

Brand: Abnova
Reference: H00005695-B03P
Product name: PSMB7 purified MaxPab mouse polyclonal antibody (B03P)
Product description: Mouse polyclonal antibody raised against a full-length human PSMB7 protein.
Gene id: 5695
Gene name: PSMB7
Gene alias: Z
Gene description: proteasome (prosome, macropain) subunit, beta type, 7
Genbank accession: NM_002799.2
Immunogen: PSMB7 (NP_002790.1, 1 a.a. ~ 277 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAAVSVYAPPVGGFSFDNCRRNAVLEADFAKRGYKLPKVRKTGTTIAGVVYKDGIVLGADTRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLSTGRLPRVVTANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFRPDMEEEEAKNLVSEAIAAGIFNDLGSGSNIDLCVISKNKLDFLRPYTVPNKKGTRLGRYRCEKGTTAVLTEKITPLEIEVLEETVQTMDTS
Protein accession: NP_002790.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005695-B03P-13-15-1.jpg
Application image note: Western Blot analysis of PSMB7 expression in transfected 293T cell line (H00005695-T04) by PSMB7 MaxPab polyclonal antibody.

Lane 1: PSMB7 transfected lysate(30.00 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PSMB7 purified MaxPab mouse polyclonal antibody (B03P) now

Add to cart