Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IF,WB-Tr |
Brand: | Abnova |
Reference: | H00005695-B03P |
Product name: | PSMB7 purified MaxPab mouse polyclonal antibody (B03P) |
Product description: | Mouse polyclonal antibody raised against a full-length human PSMB7 protein. |
Gene id: | 5695 |
Gene name: | PSMB7 |
Gene alias: | Z |
Gene description: | proteasome (prosome, macropain) subunit, beta type, 7 |
Genbank accession: | NM_002799.2 |
Immunogen: | PSMB7 (NP_002790.1, 1 a.a. ~ 277 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MAAVSVYAPPVGGFSFDNCRRNAVLEADFAKRGYKLPKVRKTGTTIAGVVYKDGIVLGADTRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLSTGRLPRVVTANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFRPDMEEEEAKNLVSEAIAAGIFNDLGSGSNIDLCVISKNKLDFLRPYTVPNKKGTRLGRYRCEKGTTAVLTEKITPLEIEVLEETVQTMDTS |
Protein accession: | NP_002790.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of PSMB7 expression in transfected 293T cell line (H00005695-T04) by PSMB7 MaxPab polyclonal antibody. Lane 1: PSMB7 transfected lysate(30.00 KDa). Lane 2: Non-transfected lysate. |
Applications: | IF,WB-Tr |
Shipping condition: | Dry Ice |