Brand: | Abnova |
Reference: | H00005690-M02 |
Product name: | PSMB2 monoclonal antibody (M02), clone M1 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant PSMB2. |
Clone: | M1 |
Isotype: | IgG1 Kappa |
Gene id: | 5690 |
Gene name: | PSMB2 |
Gene alias: | HC7-I|MGC104215|MGC126885 |
Gene description: | proteasome (prosome, macropain) subunit, beta type, 2 |
Genbank accession: | BC000268 |
Immunogen: | PSMB2 (AAH00268, 1 a.a. ~ 201 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRIIDKNGIHDLDNISFPKQGS |
Protein accession: | AAH00268 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00005690-M02-3-46-1-L.jpg](http://www.abnova.com/application_image/H00005690-M02-3-46-1-L.jpg) |
Application image note: | Immunoperoxidase of monoclonal antibody to PSMB2 on formalin-fixed paraffin-embedded human endometrium.[antibody concentration 3 ug/ml] |
Applications: | IHC-P,S-ELISA,ELISA |
Shipping condition: | Dry Ice |