Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PSMB2 monoclonal antibody (M02), clone M1
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IHC-P,S-ELISA,ELISA |
More info about PSMB2 monoclonal antibody (M02), clone M1
| Brand: | Abnova |
| Reference: | H00005690-M02 |
| Product name: | PSMB2 monoclonal antibody (M02), clone M1 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant PSMB2. |
| Clone: | M1 |
| Isotype: | IgG1 Kappa |
| Gene id: | 5690 |
| Gene name: | PSMB2 |
| Gene alias: | HC7-I|MGC104215|MGC126885 |
| Gene description: | proteasome (prosome, macropain) subunit, beta type, 2 |
| Genbank accession: | BC000268 |
| Immunogen: | PSMB2 (AAH00268, 1 a.a. ~ 201 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRIIDKNGIHDLDNISFPKQGS |
| Protein accession: | AAH00268 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to PSMB2 on formalin-fixed paraffin-embedded human endometrium.[antibody concentration 3 ug/ml] |
| Applications: | IHC-P,S-ELISA,ELISA |
| Shipping condition: | Dry Ice |