Brand: | Abnova |
Reference: | H00005682-M04 |
Product name: | PSMA1 monoclonal antibody (M04), clone 3D8 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant PSMA1. |
Clone: | 3D8 |
Isotype: | IgG2a Kappa |
Gene id: | 5682 |
Gene name: | PSMA1 |
Gene alias: | HC2|MGC14542|MGC14575|MGC14751|MGC1667|MGC21459|MGC22853|MGC23915|NU|PROS30 |
Gene description: | proteasome (prosome, macropain) subunit, alpha type, 1 |
Genbank accession: | BC002577 |
Immunogen: | PSMA1 (AAH02577, 1 a.a. ~ 263 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQKKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPTQRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFMECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDLEFTIYDDDDVSPFLEGLEERPQRKAQPAQPADEPAEKADEPMEH |
Protein accession: | AAH02577 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00005682-M04-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00005682-M04-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (54.67 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00005682-M04-9-18-1.jpg](http://www.abnova.com/application_image/H00005682-M04-9-18-1.jpg) |
Application image note: | Detection limit for recombinant GST tagged PSMA1 is approximately 3ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |