Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PSMA1 monoclonal antibody (M01A), clone S3
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about PSMA1 monoclonal antibody (M01A), clone S3
| Brand: | Abnova |
| Reference: | H00005682-M01A |
| Product name: | PSMA1 monoclonal antibody (M01A), clone S3 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant PSMA1. |
| Clone: | S3 |
| Isotype: | IgG1 Kappa |
| Gene id: | 5682 |
| Gene name: | PSMA1 |
| Gene alias: | HC2|MGC14542|MGC14575|MGC14751|MGC1667|MGC21459|MGC22853|MGC23915|NU|PROS30 |
| Gene description: | proteasome (prosome, macropain) subunit, alpha type, 1 |
| Genbank accession: | BC002577 |
| Immunogen: | PSMA1 (AAH02577, 1 a.a. ~ 263 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQKKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPTQRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFMECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDLEFTIYDDDDVSPFLEGLEERPQRKAQPAQPADEPAEKADEPMEH |
| Protein accession: | AAH02577 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (54.67 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | PSMA1 monoclonal antibody (M01A), clone 1D9-1C7 Western Blot analysis of PSMA1 expression in HeLa ( Cat # L013V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |