Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PSMA1 monoclonal antibody (M01), clone 1D9-1C7
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
More info about PSMA1 monoclonal antibody (M01), clone 1D9-1C7
| Brand: | Abnova |
| Reference: | H00005682-M01 |
| Product name: | PSMA1 monoclonal antibody (M01), clone 1D9-1C7 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant PSMA1. |
| Clone: | 1D9-1C7 |
| Isotype: | IgG1 kappa |
| Gene id: | 5682 |
| Gene name: | PSMA1 |
| Gene alias: | HC2|MGC14542|MGC14575|MGC14751|MGC1667|MGC21459|MGC22853|MGC23915|NU|PROS30 |
| Gene description: | proteasome (prosome, macropain) subunit, alpha type, 1 |
| Genbank accession: | BC002577 |
| Immunogen: | PSMA1 (AAH02577, 1 a.a. ~ 263 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQKKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPTQRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFMECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDLEFTIYDDDDVSPFLEGLEERPQRKAQPAQPADEPAEKADEPMEH |
| Protein accession: | AAH02577 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (54.67 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | PSMA1 monoclonal antibody (M01), clone 1D9-1C7 Western Blot analysis of PSMA1 expression in HeLa ( Cat # L013V1 ). |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
| Shipping condition: | Dry Ice |
| Publications: | The Role of Translationally Controlled Tumor Protein in Tumor Growth and Metastasis of Colon Adenocarcinoma Cells.Ma Q, Geng Y, Xu W, Wu Y, He F, Shu W, Huang M, Du H, Li M. J Proteome Res. 2009 Aug 11. [Epub ahead of print] |