Reference: | H00005681-Q01 |
Product name: | PSKH1 (Human) Recombinant Protein (Q01) |
Product description: | Human PSKH1 partial ORF ( AAH62616, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal. |
Gene id: | 5681 |
Gene name: | PSKH1 |
Gene alias: | - |
Gene description: | protein serine kinase H1 |
Genbank accession: | BC062616 |
Immunogen sequence/protein sequence: | MGCGTSKVLPEPPKDVQLDLVKKVEPFSGTKSDVYKHFITEVDSVGPVKAGFPAASQYAHPCPGPPTAGHTEPPSEPPRRARVAKYRAKFDPRVTAKYDI |
Protein accession: | AAH62616 |
Preparation method: | in vitro wheat germ expression system |
Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Note: | Best use within three months from the date of receipt of this protein. |
Tag: | GST |
Shipping condition: | Dry Ice |