Brand: | Abnova |
Reference: | H00005655-M01A |
Product name: | KLK10 monoclonal antibody (M01A), clone 1G8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant KLK10. |
Clone: | 1G8 |
Isotype: | IgG1 Lambda |
Gene id: | 5655 |
Gene name: | KLK10 |
Gene alias: | NES1|PRSSL1 |
Gene description: | kallikrein-related peptidase 10 |
Genbank accession: | NM_002776 |
Immunogen: | KLK10 (NP_002767, 167 a.a. ~ 276 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | DQCQVAGWGTTAARRVKYNKGLTCSSITILSPKECEVFYPGVVTNNMICAGLDRGQDPCQSDSGGPLVCDETLQGILSWGVYPCGSAQHPAVYTQICKYMSWINKVIRSN |
Protein accession: | NP_002767 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | KLK10 monoclonal antibody (M01A), clone 1G8 Western Blot analysis of KLK10 expression in A-431( Cat # L015V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |