KLK10 monoclonal antibody (M01A), clone 1G8 View larger

KLK10 monoclonal antibody (M01A), clone 1G8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of KLK10 monoclonal antibody (M01A), clone 1G8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about KLK10 monoclonal antibody (M01A), clone 1G8

Brand: Abnova
Reference: H00005655-M01A
Product name: KLK10 monoclonal antibody (M01A), clone 1G8
Product description: Mouse monoclonal antibody raised against a partial recombinant KLK10.
Clone: 1G8
Isotype: IgG1 Lambda
Gene id: 5655
Gene name: KLK10
Gene alias: NES1|PRSSL1
Gene description: kallikrein-related peptidase 10
Genbank accession: NM_002776
Immunogen: KLK10 (NP_002767, 167 a.a. ~ 276 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: DQCQVAGWGTTAARRVKYNKGLTCSSITILSPKECEVFYPGVVTNNMICAGLDRGQDPCQSDSGGPLVCDETLQGILSWGVYPCGSAQHPAVYTQICKYMSWINKVIRSN
Protein accession: NP_002767
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005655-M01A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005655-M01A-1-4-1.jpg
Application image note: KLK10 monoclonal antibody (M01A), clone 1G8 Western Blot analysis of KLK10 expression in A-431( Cat # L015V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy KLK10 monoclonal antibody (M01A), clone 1G8 now

Add to cart