KLK10 MaxPab rabbit polyclonal antibody (D01) View larger

KLK10 MaxPab rabbit polyclonal antibody (D01)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of KLK10 MaxPab rabbit polyclonal antibody (D01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIP

More info about KLK10 MaxPab rabbit polyclonal antibody (D01)

Brand: Abnova
Reference: H00005655-D01
Product name: KLK10 MaxPab rabbit polyclonal antibody (D01)
Product description: Rabbit polyclonal antibody raised against a full-length human KLK10 protein.
Gene id: 5655
Gene name: KLK10
Gene alias: NES1|PRSSL1
Gene description: kallikrein-related peptidase 10
Genbank accession: BC002710
Immunogen: KLK10 (AAH02710.1, 1 a.a. ~ 276 a.a) full-length human protein.
Immunogen sequence/protein sequence: MRAPHLHLSAASGARALAKLLPLLMAQLWAAEAALLPQNDTRLDPEAYGAPCARGSQPWQVSLFNGLSFHCAGVLVDQSWVLTAAHCGNKPLWARVGDDHLLLLQGEQLRRTTRSVVHPKYHQGSGPILPRRTDEHDLMLLKLARPVVPGPRVRALQLPYRCAQPGDQCQVAGWGTTAARRVKYNKGLTCSSITILSPKECEVFYPGVVTNNMICAGLDRGQDPCQSDSGGPLVCDETLQGILSWGVYPCGSAQHPAVYTQICKYMSWINKVIRSN
Protein accession: AAH02710.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00005655-D01-31-15-1.jpg
Application image note: Immunoprecipitation of KLK10 transfected lysate using anti-KLK10 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with KLK10 purified MaxPab mouse polyclonal antibody (B01P) (H00005655-B01P).
Applications: IP
Shipping condition: Dry Ice

Reviews

Buy KLK10 MaxPab rabbit polyclonal antibody (D01) now

Add to cart