KLK7 MaxPab rabbit polyclonal antibody (D01) View larger

KLK7 MaxPab rabbit polyclonal antibody (D01)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of KLK7 MaxPab rabbit polyclonal antibody (D01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr,IP

More info about KLK7 MaxPab rabbit polyclonal antibody (D01)

Brand: Abnova
Reference: H00005650-D01
Product name: KLK7 MaxPab rabbit polyclonal antibody (D01)
Product description: Rabbit polyclonal antibody raised against a full-length human KLK7 protein.
Gene id: 5650
Gene name: KLK7
Gene alias: PRSS6|SCCE
Gene description: kallikrein-related peptidase 7
Genbank accession: NM_005046.2
Immunogen: KLK7 (NP_005037.1, 1 a.a. ~ 253 a.a) full-length human protein.
Immunogen sequence/protein sequence: MARSLLLPLQILLLSLALETAGEEAQGDKIIDGAPCARGSHPWQVALLSGNQLHCGGVLVNERWVLTAAHCKMNEYTVHLGSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNSQARLSSMVKKVRLPSRCEPPGTTCTVSGWGTTTSPDVTFPSDLMCVDVKLISPQDCTKVYKDLLENSMLCAGIPDSKKNACNGDSGGPLVCRGTLQGLVSWGTFPCGQPNDPGVYTQVCKFTKWINDTMKKHR
Protein accession: NP_005037.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00005650-D01-13-15-1.jpg
Application image note: Western Blot analysis of KLK7 expression in transfected 293T cell line (H00005650-T02) by KLK7 MaxPab polyclonal antibody.

Lane 1: KLK7 transfected lysate(27.50 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr,IP
Shipping condition: Dry Ice

Reviews

Buy KLK7 MaxPab rabbit polyclonal antibody (D01) now

Add to cart