KLK7 purified MaxPab mouse polyclonal antibody (B01P) View larger

KLK7 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of KLK7 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,WB-Tr

More info about KLK7 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00005650-B01P
Product name: KLK7 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human KLK7 protein.
Gene id: 5650
Gene name: KLK7
Gene alias: PRSS6|SCCE
Gene description: kallikrein-related peptidase 7
Genbank accession: BC032005
Immunogen: KLK7 (AAH32005, 1 a.a. ~ 253 a.a) full-length human protein.
Immunogen sequence/protein sequence: MARSLLLPLQILLLSLALETAGEEAQGDKIIDGAPCARGSHPWQVALLSGNQLHCGGVLVNERWVLTAAHCKMNEYTVHLGSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNSQARLSSMVKKVRLPSRCEPPGTTCTVSGWGTTTSPDVTFPSDLMCVDVKLISPQDCTKVYKDLLENSMLCAGIPDSKKNACNGDSGGPLVCRGTLQGLVSWGTFPCGQPNDPGVYTQVCKFTKWINDTMKKHR
Protein accession: AAH32005
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005650-B01P-13-15-1.jpg
Application image note: Western Blot analysis of KLK7 expression in transfected 293T cell line (H00005650-T01) by KLK7 MaxPab polyclonal antibody.

Lane 1: KLK7 transfected lysate(27.94 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy KLK7 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart