PRSS2 purified MaxPab rabbit polyclonal antibody (D01P) View larger

PRSS2 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PRSS2 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ti,WB-Tr

More info about PRSS2 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00005645-D01P
Product name: PRSS2 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human PRSS2 protein.
Gene id: 5645
Gene name: PRSS2
Gene alias: MGC111183|MGC120174|TRY2|TRY8|TRYP2
Gene description: protease, serine, 2 (trypsin 2)
Genbank accession: NM_002770
Immunogen: PRSS2 (NP_002761.1, 1 a.a. ~ 247 a.a) full-length human protein.
Immunogen sequence/protein sequence: MNLLLILTFVAAAVAAPFDDDDKIVGGYICEENSVPYQVSLNSGYHFCGGSLISEQWVVSAGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPKYNSRTLDNDILLIKLSSPAVINSRVSAISLPTAPPAAGTESLISGWGNTLSSGADYPDELQCLDAPVLSQAECEASYPGKITNNMFCVGFLEGGKDSCQGDSGGPVVSNGELQGIVSWGYGCAQKNRPGVYTKVYNYVDWIKDTIAANS
Protein accession: NP_002761.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00005645-D01P-13-15-1.jpg
Application image note: Western Blot analysis of PRSS2 expression in transfected 293T cell line (H00005645-T03) by PRSS2 MaxPab polyclonal antibody.

Lane 1: PRSS2 transfected lysate(26.50 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PRSS2 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart