Brand: | Abnova |
Reference: | H00005644-B01 |
Product name: | PRSS1 MaxPab mouse polyclonal antibody (B01) |
Product description: | Mouse polyclonal antibody raised against a full-length human PRSS1 protein. |
Gene id: | 5644 |
Gene name: | PRSS1 |
Gene alias: | MGC120175|MGC149362|TRP1|TRY1|TRY4|TRYP1 |
Gene description: | protease, serine, 1 (trypsin 1) |
Genbank accession: | NM_002769.2 |
Immunogen: | PRSS1 (NP_002760.1, 1 a.a. ~ 247 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MNPLLILTFVAAALAAPFDDDDKIVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVSAGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVINARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKITSNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIKNTIAANS |
Protein accession: | NP_002760.1 |
Storage buffer: | No additive |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Note: | For IHC and IF applications, antibody purification with Protein A will be needed prior to use. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | PRSS1 MaxPab polyclonal antibody. Western Blot analysis of PRSS1 expression in human pancreas. |
Applications: | WB-Ti,WB-Tr |
Shipping condition: | Dry Ice |