PRSS1 polyclonal antibody (A01) View larger

PRSS1 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PRSS1 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about PRSS1 polyclonal antibody (A01)

Brand: Abnova
Reference: H00005644-A01
Product name: PRSS1 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant PRSS1.
Gene id: 5644
Gene name: PRSS1
Gene alias: MGC120175|MGC149362|TRP1|TRY1|TRY4|TRYP1
Gene description: protease, serine, 1 (trypsin 1)
Genbank accession: NM_002769
Immunogen: PRSS1 (NP_002760, 138 a.a. ~ 247 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: KCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKITSNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIKNTIAANS
Protein accession: NP_002760
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005644-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (38.21 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PRSS1 polyclonal antibody (A01) now

Add to cart